Related Experiment Video
Updated: Jul 10, 2026

Extraction and Purification of FAHD1 Protein from Swine Kidney and Mouse Liver
Published on: February 18, 2022
Purification and expression of a processing protease on beta-alanine-oxoglutarate aminotransferase from rat liver
Tomoko Ohyama1, Koichi Matsuda, Hideyuki Tachibana
1Faculty of Nutrition and High Technology Research Center, Kobe-Gakuin University, Arise 518, Ikawadani-cho, Nishi-ku, Kobe 651-2180, Japan. f9blh801@nutr.kobegakuin.ac.jp
Abstract:
GABA[arrow beta]AlaAT convertase is an endopeptidase that processes brain-type 4-aminobutyrate aminotransferase (GABA AT; EC 2.6.1.19) to liver-type beta-alanine-oxoglutarate aminotransferase (beta-AlaAT I) in rats. Its molecular mass was 180 kDa as determined by gel filtration. A subunit molecular mass of 97652 Da was measured using MALDI-TOF MS. The N-terminal sequence of the purified GABA[arrow beta]AlaAT convertase was SRVEVSKVLILGSGGLSIGQAGEFDYSGSQAV- and was identical to residues 418-449 of carbamoyl-phosphate synthetase I (CPS I; EC 1.2.1.27) purified from rat liver. The subunit molecular mass and the N-terminal amino acid sequence suggested that GABA[arrow beta]AlaAT convertase was the 418-1305 peptide of CPS I. An expression vector containing the coding region of the 418-1305 peptide of rat CPS I was transfected into NIH3T3 cells and the extract of the cells showed GABA[arrow beta]AlaAT convertase activity.
Related Concept Videos
Mitochondrial Precursor Proteins
Most of the mitochondrial precursors...
Translocation of Proteins into the Mitochondria
Sorting of outer membrane proteins:
Mitochondrial outer membrane proteins are of two types: the transmembrane, beta-barrel porins, and the membrane-anchored, alpha-helical proteins. Beta-barrel porin precursors are translocated by the TOM complex and inserted into the outer mitochondrial membrane by the SAM complex. In contrast,...

