Disruption mechanism in the helix of SPF peptide by interchanging E5 and K10 residues: inference from molecular
P N Sunilkumar1, Divya G Nair, C Sadasivan
1Department of Biotechnology and Microbiology, School of Life Sciences, Kannur University, Thalassery Campus, Kerala-670 661, India.
Abstract:
Seminalplasmin (SPLN) is a 47-residue peptide (SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV) from bovine seminal plasma. It has broad spectrum antimicrobial activity, without any hemolytic activity. The 28-40 segment of SPLN with the sequence PKLLETFLSKWIG, designated as SPF, is the most hydrophobic stretch of SPLN and primarily responsible for the membrane-perturbing activity of SPLN. It was reported that SPF has a helical structure and the interchange of E5 and K10 residues disrupted the helical structure. The present paper reports a possible mechanism of disruption of the helical structure of SPF peptide during the interchange of E5 and K10 residues. The result is based on simulated annealing and molecular dynamics simulation studies on SPF and its four analogues with K10E, K10D, E5K, and E5K & K10E substitutions. It showed that K10 residue has a critical role in maintaining the highest helical content and the positions of charged residues are also very important for maintaining the helical structure of the SPF peptide. Formation of some new long-range hydrogen bonds and the rupture of some short-range hydrogen bonds involving the tenth residue led to the disruption of helical structure of SPF peptide when E5 and K10 residues are interchanged.
Insights
The helical structure of the SPF peptide, crucial for its antimicrobial activity, is disrupted by specific amino acid substitutions. Molecular simulations reveal that charged residue positions, particularly K10, are vital for maintaining SPF
Area of Science:
- Biochemistry and Molecular Biology
- Computational Biophysics
Background:
- Seminalplasmin (SPLN) is a bovine seminal plasma peptide with broad-spectrum antimicrobial activity and no hemolytic effects.
- The 28-40 segment, SPF, is hydrophobic, responsible for membrane perturbation, and possesses a helical structure.
Purpose of the Study:
- To investigate the mechanism by which interchanging E5 and K10 residues disrupts the helical structure of the SPF peptide.
- To understand the role of charged residues and hydrogen bonding in maintaining SPF's helical conformation.
Main Methods:
- Simulated annealing and molecular dynamics simulations were performed on SPF and four analogues with specific amino acid substitutions (K10E, K10D, E5K, E5K & K10E).
- Analysis focused on changes in helical content and hydrogen bond formation/rupture.
Main Results:
- The K10 residue plays a critical role in maintaining the highest helical content in the SPF peptide.
- Specific substitutions, particularly E5K and K10E, disrupt the helical structure.
- Disruption involves the formation of new long-range hydrogen bonds and the rupture of short-range bonds involving the K10 residue.
Conclusions:
- The positions of charged residues, especially K10, are crucial for the helical stability of the SPF peptide.
- Understanding these structural dynamics provides insights into the mechanism of action for antimicrobial peptides.
More Related Videos
Related Concept Videos
Protein Folding
Protein Structure Is Critical to Its Biological Function
Proteins perform a wide range of biological functions such as catalyzing chemical reactions, providing...
Molecular Chaperones and Protein Folding
The...


