Related Experiment Video
Updated: May 22, 2026

Production and Visualization of Bacterial Spheroplasts and Protoplasts to Characterize Antimicrobial Peptide Localization
Published on: August 11, 2018
Discovery of potent antimicrobial peptide analogs of Ixosin-B
Feng-Di T Lung1, Kai-Shiuan Wang, Zih-Jie Liao
1Department of Chemistry, Tunghai University, Taichung 407, Taiwan, ROC. fdlung@thu.edu.tw
Abstract:
Antimicrobial peptides (AMPs) represent the first defense line against infection when organisms are infected by pathogens. These peptides are generally good targets for the development of antimicrobial agents. Peptide amide analogs of Ixosin-B, an antimicrobial peptide with amino acid sequence of QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY, were designed, synthesized and examined for antimicrobial activities against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. Within the peptides synthesized, we discovered an 11-mer peptide, KRLRRVWRRWR-amide, which exhibited potent antimicrobial activity while very little hemolytic activity in human erythrocytes was observed even at high dose level (100 μM). With further modifications, this peptide could be developed into a potent antimicrobial agent in the future.
Related Concept Videos
Antimicrobial Proteins
Interferons
Interferons (IFNs) are proteins produced by lymphocytes, macrophages, and fibroblasts infected with viruses. While IFNs cannot prevent viruses from entering and...
Inhibitors of Bacterial Protein Synthesis
Production of Pharmaceuticals
Inhibitors of Gram-positive Cell Wall Synthesis
Inhibitors of Viral Protein Synthesis
Clinical Significance of Antibiotic Resistance

