Related Experiment Video
Updated: Aug 5, 2026

Fabrication and Implantation of Miniature Dual-element Strain Gages for Measuring In Vivo Gastrointestinal Contractions in Rodents.
Published on: September 18, 2014
Opossum (Didelphis virginiana) "little" and "big" gastrins
Y Shinomura1, J Eng, S C Rattan
1Solomon A. Berson Research Laboratory, Veterans Administration Medical Center, Bronx, NY 10468.
Abstract:
1. "Little" gastrins from most mammalian species are 17 amino acid peptides and the precursor "big" gastrins are 34 amino acid peptides. 2. "Little" gastrins of the New World hystricomorphs, guinea-pig and chinchilla, are 16 amino acid peptides due to deletion of a glutamic acid in the region 6-9 from their NH2-terminus and the corresponding "big" gastrins are 33 amino acid peptides. 3. Antral gastrins from the opossum, a New World marsupial, have a glutamic acid deletion in the same region as the hystricomorph gastrins. 4. Opossum "big" gastrin is a 33 amino acid peptide with the following sequence: less than ELGPQDLPYLTADLSKKQGPWLEEEEAYGWMDF#.
More Related Videos
Related Concept Videos
What is Monogastric Digestion?
Lipid Digestion
Hormonal Regulation
Intestinal Phase of Digestion
The arrival of the chyme in the small intestine distends the duodenum, which triggers the enterogastric reflex. This distension...
Microbiota of the Stomach and Small Intestine
Pyloric Obstruction

