Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

Preparation of 1° Amines: Azide Synthesis01:22

Preparation of 1° Amines: Azide Synthesis

2.6K
Direct alkylation of ammonia produces polyalkylated amines, along with a quaternary ammonium salt. To exclusively prepare primary amines, the azide synthesis method can be used.
Azide ions act as good nucleophiles and react with unhindered alkyl halides to form alkyl azides. Alkyl azides do not participate in further nucleophilic substitution reactions, thereby eliminating the chances of polyalkylated products. Alkyl azides are reduced by hydride-based reducing agents, like lithium aluminum...
2.6K
Peptide Bonds02:43

Peptide Bonds

54.1K
A peptide bond covalently attaches amino acids through a dehydration reaction. One amino acid's carboxyl group and another amino acid's amino group combine, releasing a water molecule. The resulting bond is the peptide bond. The products that such linkages form are peptides. As more amino acids join this growing chain, the resulting chain is a polypeptide. Each polypeptide has a free amino group at one end. This end has the N-terminal, or the amino-terminal, and the other end has a free...
54.1K
Preparation of Amides01:29

Preparation of Amides

3.4K
Amides are synthesized by treating carboxylic acids with amines in the presence of dehydrating agents like dicyclohexylcarbodiimide (DCC).
The DCC-promoted synthesis of amides begins with the protonation of DCC by carboxylic acid. The protonation makes it a better acceptor. Next, the addition of carboxylate to the protonated carbodiimide gives a reactive acylating agent.
Subsequently, the amine acts as a nucleophile that attacks the acylating agent to form a tetrahedral intermediate. In the...
3.4K
Protein Complex Assembly02:41

Protein Complex Assembly

12.5K
Proteins can form homomeric complexes with another unit of the same protein or heteromeric complexes with different types.  Most protein complexes self-assemble spontaneously via ordered pathways, while some proteins need assembly factors that guide their proper assembly. Despite the crowded intracellular environment, proteins usually interact with their correct partners and form functional complexes.
Many viruses self-assemble into a fully functional unit using the infected host cell to...
12.5K
Peptidoglycan Synthesis01:28

Peptidoglycan Synthesis

4.7K
Structure of PeptidoglycanPeptidoglycan is a vital structural component of the bacterial cell wall, providing mechanical strength and shape to the cell. It consists of repeating units of two sugars—N-acetylglucosamine (NAG) and N-acetylmuramic acid (NAM)—linked by β-1,4 glycosidic bonds. These sugar chains are cross-linked by short peptide chains, forming a mesh-like polymer that surrounds the bacterial plasma membrane.Cytoplasmic Phase – Precursor SynthesisPeptidoglycan...
4.7K

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Rewiring of auxin and MAPK signaling is associated with contrasting shoestring and fern-like manifestations in ToBRFV-A134T-infected tomato.

Frontiers in plant science·2026
Same author

Pillar[5]arene-Based Self-Assembled Organic Nanosheets: Engineered for Superior Mechanical Strength and Ion Conductivity.

ACS applied materials & interfaces·2026
Same author

Valorisation of banana stem into N-doped activated carbon as a selective sorbent for cationic dyes and pharmaceutical contaminants.

RSC advances·2026
Same author

NBD Integrated and Vitamin B6-Driven Charge-Reversible Peptide-Based Nanocarriers for Targeted Therapeutic Delivery.

Small (Weinheim an der Bergstrasse, Germany)·2026
Same author

Self-assembled π-conjugated Cu(ii)-phenanthro[9,10-<i>d</i>]imidazole superstructures for VOC sensing and enhanced supercapacitor performance.

Nanoscale advances·2025
Same author

Characterising supramolecular gels: general discussion.

Faraday discussions·2025

Related Experiment Video

Updated: Apr 28, 2026

Formation of Ordered Biomolecular Structures by the Self-assembly of Short Peptides
07:26

Formation of Ordered Biomolecular Structures by the Self-assembly of Short Peptides

Published on: November 21, 2013

12.4K

Self-assembly of azide containing dipeptides.

Sivan Yuran1, Yair Razvag, Priyadip Das

  • 1The Institute of Chemistry and The Center for Nanoscience and Nanotechnology, The Hebrew University of Jerusalem, 91904, Jerusalem, Israel.

Journal of Peptide Science : an Official Publication of the European Peptide Society
|June 4, 2014
PubMed
Summary

Researchers explored self-assembling peptides with azide groups. UV light irradiation altered the porous spherical structures, enhancing their mechanical properties and stability for advanced materials.

Keywords:
azideco-assemblycross-linkingdiphenylalaninepeptidesself-assembly

More Related Videos

A Tripeptide-Stabilized Nanoemulsion of Oleic Acid
10:42

A Tripeptide-Stabilized Nanoemulsion of Oleic Acid

Published on: February 27, 2019

8.4K
Synthesis and Characterization of 1,2-Dithiolane Modified Self-Assembling Peptides
09:54

Synthesis and Characterization of 1,2-Dithiolane Modified Self-Assembling Peptides

Published on: August 20, 2018

6.8K

Related Experiment Videos

Last Updated: Apr 28, 2026

Formation of Ordered Biomolecular Structures by the Self-assembly of Short Peptides
07:26

Formation of Ordered Biomolecular Structures by the Self-assembly of Short Peptides

Published on: November 21, 2013

12.4K
A Tripeptide-Stabilized Nanoemulsion of Oleic Acid
10:42

A Tripeptide-Stabilized Nanoemulsion of Oleic Acid

Published on: February 27, 2019

8.4K
Synthesis and Characterization of 1,2-Dithiolane Modified Self-Assembling Peptides
09:54

Synthesis and Characterization of 1,2-Dithiolane Modified Self-Assembling Peptides

Published on: August 20, 2018

6.8K

Area of Science:

  • Materials Science
  • Biochemistry
  • Nanotechnology

Background:

  • Nature utilizes self-assembly to create functional structures and materials.
  • Mimicking self-assembly in vitro offers potential for novel materials in energy, biomaterials, and drug delivery.
  • Peptides, with their diverse structures, are promising building blocks for in vitro self-assembly.

Purpose of the Study:

  • To investigate the self-assembly of three aromatic dipeptides containing an azide moiety.
  • To explore the impact of UV light irradiation on the morphology and mechanical properties of self-assembled peptide structures.
  • To assess the potential of azide-functionalized peptides for creating advanced materials.

Main Methods:

  • Synthesis and self-assembly of three aromatic dipeptides: H-Phe(4-azido)-Phe(4-azido)-OH, H-Phe(4-azido)-Phe-OH, and H-Phe-Phe(4-azido)-OH.
  • Characterization of self-assembled structures using electron microscopy and FT-IR spectroscopy.
  • Evaluation of mechanical properties using atomic force microscopy (AFM) indentation experiments.

Main Results:

  • H-Phe(4-azido)-Phe(4-azido)-OH self-assembled into porous spherical structures; the other two dipeptides did not form ordered structures.
  • UV light irradiation induced structural changes in the porous spherical assemblies.
  • FT-IR confirmed chemical changes in the peptide azido group upon irradiation.
  • AFM revealed an increase in the Young's modulus of the spherical assemblies after UV irradiation, indicating enhanced mechanical stability.

Conclusions:

  • The azide moiety in dipeptides can be photo-cross-linked by UV light, altering self-assembled morphology and mechanical properties.
  • Self-assembled peptide structures with azide groups can be modified to create stiffer and more stable materials.
  • These findings open possibilities for designing advanced peptide-based materials with tunable properties for various applications.