Related Experiment Videos
Amino acid sequence of exogastrula-inducing peptide C from the sea urchin, Anthocidaris crassispina
T Suyemitsu1, Y Tonegawa, K Ishihara
1Department of Regulation Biology, Faculty of Science, Saitama University, Japan.
Biochimica Et Biophysica Acta
|November 9, 1989
Abstract:
The complete amino acid sequence of exogastrula-inducing peptide C from embryos of the sea urchin, Anthocidaris crassispina has been determined by analysis of the amino acid sequences in the S-pyridylethylated peptide C and the peptides generated after digestion of the peptide C with arginyl endopeptidase. Exogastrula-inducing peptide C was composed of 58 amino acid residues and its molecular weight was calculated to be 6464. The sequence was DTKGGCERATNNCNGHGDCVQGRWGQYYCKCTLPYRVGGSESSCYMPKDKEEDVEIET.