An insecticidal toxin from Nephila clavata spider venom

Area of Science:

• Biochemistry
• Toxicology
• Entomology

Background:

• Spiders utilize venomous insecticidal peptides as effective biochemical weapons for predation.
• Insecticidal toxins from spider venom offer a promising source for natural, human-safe agricultural compounds due to their specificity and potency.

Purpose of the Study:

• To identify and characterize a novel insecticidal toxin from the venom of Nephila clavata.
• To evaluate the potential of this new toxin as a basis for developing novel bioinsecticides.

Main Methods:

• Automated Edman degradation, cDNA cloning, and MS/MS analysis were used to determine the primary sequence of the novel toxin.
• BLAST searches were performed to assess sequence similarity with known peptides and proteins.
• Electrophysiological studies were conducted to investigate the toxin's effects on insect neuronal ion channels.

Main Results:

• A novel insecticidal toxin, designated μ-NPTX-Nc1a, was identified from Nephila clavata venom.
• The primary sequence of μ-NPTX-Nc1a (GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG) showed no similarity to known peptides, indicating a new toxin family.
• μ-NPTX-Nc1a inhibited Na_V and K_V channels in cockroach neurons, with a median lethal dose (LD50) of 573 ng/g against cockroaches.

Conclusions:

• μ-NPTX-Nc1a represents a novel class of insecticidal peptide.
• This toxin's specific action on insect ion channels and its efficacy against cockroaches suggest its potential as a lead compound for new bioinsecticide development.