Related Experiment Video

Updated: Jan 28, 2026

Direct Re-implantation of Left Coronary Artery into the Aorta in Adults with Anomalous Origin of Left Coronary Artery from the Pulmonary Artery ALCAPA
13:10

Direct Re-implantation of Left Coronary Artery into the Aorta in Adults with Anomalous Origin of Left Coronary Artery from the Pulmonary Artery ALCAPA

Published on: April 24, 2017

19.2K

Association of high mobility group box 1 protein with coronary artery disease

Necla Benlier1, Mustafa Bilge Erdoğan2, Serdar Keçioğlu3

  • 11 Department of Medical Pharmacology, Faculty of Medicine, Sanko University, Gaziantep, Turkey.

Asian Cardiovascular & Thoracic Annals
|March 2, 2019
PubMed

Insights

Serum high mobility group box 1 protein is elevated in coronary artery disease patients compared to healthy individuals. This inflammatory biomarker showed no association with common coronary artery disease risk factors in the study.

Area of Science:

  • Cardiovascular Medicine
  • Inflammation Research
  • Biomarker Discovery

Background:

  • Inflammation plays a crucial role in coronary artery disease (CAD).
  • Numerous studies explore inflammatory biomarkers and their link to adverse cardiovascular outcomes.
  • The association between high mobility group box 1 protein (HMGB1) and CAD risk factors requires further investigation.

Purpose of the Study:

  • To investigate the relationship between serum HMGB1 levels and established risk factors for CAD.
  • To compare HMGB1 levels in patients with CAD undergoing coronary artery bypass surgery versus healthy controls.

Main Methods:

  • A cohort of 55 CAD patients and 50 healthy controls was recruited.
  • Demographic data, medical history, and cardiovascular risk factors were collected.
  • Serum HMGB1 levels were measured and compared between the patient and control groups.

Main Results:

  • No significant differences in age or sex were observed between groups.
  • CAD patients exhibited a higher prevalence of family history of CAD, hypertension, and type 2 diabetes.
  • Serum HMGB1 levels were significantly elevated in CAD patients compared to healthy controls (p=0.001).

Conclusions:

  • Serum HMGB1 is significantly increased in individuals with coronary artery disease.
  • No correlation was identified between elevated HMGB1 levels and common CAD risk factors.
Abstract

Keywords:
Coronary artery diseaseHMGB1 proteincytokineshyperlipidemiasinflammationrisk factors

More Related Videos

Signal Acquisition, Score Interpretation, and Economics of a Non-Invasive Point-of-Care Test for Coronary Artery Disease06:16

Signal Acquisition, Score Interpretation, and Economics of a Non-Invasive Point-of-Care Test for Coronary Artery Disease

Published on: August 9, 2024

834
Identifying Coronary Artery Calcification on Non-gated Computed Tomography Scans04:40

Identifying Coronary Artery Calcification on Non-gated Computed Tomography Scans

Published on: August 28, 2018

16.0K

Related Concept Videos

Coronary Artery Disease I: Introduction01:30

Coronary Artery Disease I: Introduction

Coronary Artery Disease (CAD): An Overview with Scientific InsightsCoronary Artery Disease (CAD), often referred to as C-A-D, is a prevalent blood vessel disorder classified under the broader category of atherosclerosis. Atherosclerosis is a pathological process characterized by the hardening and narrowing of arteries due to the accumulation of atherosclerotic plaques. These plaques are composed of cholesterol, fatty substances, inflammatory cells, calcium, and fibrin, reducing blood flow to...
1.1K
Coronary Artery Disease II: Pathophysiology01:26

Coronary Artery Disease II: Pathophysiology

Coronary Artery Disease (CAD) originates from a series of events that impair the function of coronary arteries, the blood vessels responsible for delivering oxygen-rich blood to the heart muscle. The pathophysiology of CAD is closely linked to atherosclerosis, a chronic inflammatory and lipid-driven condition affecting the vascular endothelium.1. Endothelial DamageThe process begins with damage to the vascular endothelium, which serves as a protective barrier between the blood and the vessel...
420
Coronary Artery Disease V: Interprofessional Care01:27

Coronary Artery Disease V: Interprofessional Care

Interprofessional care for coronary artery disease includes pharmacological therapy and revascularization procedures.Pharmacological therapy for Coronary Artery Disease (CAD) aims to manage symptoms, prevent complications, and improve patient outcomes through various classes of medications:Antiplatelet Agents:Aspirin and Clopidogrel: These medications inhibit platelet aggregation, preventing blood clots, which is crucial for avoiding heart attacks and strokes. Doctors often prescribe these...
249
Coronary Artery Disease III: Clinical Manifestations01:30

Coronary Artery Disease III: Clinical Manifestations

Coronary Artery Disease (CAD) is a primary health risk worldwide, leading to significant morbidity and mortality. The condition arises from the buildup of atherosclerotic plaques within the coronary arteries, resulting in diminished blood supply to the heart muscle.The clinical manifestations of CAD vary widely, from asymptomatic stages to severe, life-threatening conditions. Understanding these manifestations is crucial for early diagnosis and effective management.Angina Pectoris: The Warning...
364
Coronary Artery Disease IV: Preventive Measures01:26

Coronary Artery Disease IV: Preventive Measures

Effective preventive measures for coronary artery disease (CAD) focus on controlling modifiable risk factors, including cholesterol abnormalities and lifestyle changes.Cholesterol ManagementFirst, the Mediterranean diet and the American Heart Association advocate for maintaining low-density lipoprotein (LDL) cholesterol levels below 100 mg/dL, with a more stringent recommendation of below 70 mg/dL for individuals at high risk. LDL cholesterol, often termed "bad cholesterol," can lead to the...
663
Peripheral Artery Disease I: Introduction01:30

Peripheral Artery Disease I: Introduction

Peripheral artery disease (PAD) predominantly results from atherosclerosis, which involves the accumulation of fatty deposits, or plaques, within the walls of arteries. This causes them to narrow and harden, significantly reducing blood flow. PAD predominantly affects the legs, particularly the arteries supplying the thighs and calves. In rare cases, it may involve other arteries, including those in the arms.Etiology of PAD:The principal cause of PAD is atherosclerosis, which results from fatty...
375