The Correlation between Subolesin-Reactive Epitopes and Vaccine Efficacy

Area of Science:

• Veterinary immunology
• Parasitology
• Vaccine development

Background:

• Tick control in cattle is crucial for animal health and agricultural productivity.
• Subolesin (SUB) antigen has demonstrated protective capabilities in tick vaccines.
• Quantum vaccinomics has identified potential SUB-protective epitopes and protein interaction sites.

Purpose of the Study:

• To map B-cell linear epitopes of Subolesin (SUB) from three key tick species in Uganda.
• To evaluate the effectiveness of epitope mapping for identifying protective epitopes in SUB-based vaccines.
• To correlate identified epitopes with vaccine protection and efficacy in cattle.

Main Methods:

• Epitope mapping of SUB from Rhipicephalus appendiculatus, R. decoloratus, and Amblyomma variegatum using peptide arrays.
• Analysis of serum samples from two cattle breeds immunized with SUB-based vaccines and control groups.
• Statistical analysis (Z-score and Z-ratio) to identify significant B-cell reactive epitopes.

Main Results:

• All reactive peptides recognized by IgG in cattle immunized with R. appendiculatus SUB (SUBra) were significant compared to controls.
• Identified overlapping epitopes in highly efficacious vaccines: Bos indicus with SUB cocktail (92%) and crossbred cattle with SUBra (90%).
• A key peptide sequence (SPTGLSPGLSPVRDQPLFTFRQVGLICERMMKERESQIRDEYDHVLSAKLAEQYDTFVKFTYDQKRFEGATPSYLS) was recognized by IgG from high-efficacy groups, partially corresponding to a Q38 peptide and SUB protein interaction domain.

Conclusions:

• Identified SUB epitopes are potentially linked to the protection and efficacy of SUB-based tick vaccines.
• Epitope mapping is a valuable strategy for identifying protective epitopes and advancing vaccine development.
• Novel chimeric vaccines incorporating these protective epitopes can be designed for improved tick control.