Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

Multimachine Stability01:25

Multimachine Stability

208
Multimachine stability analysis is crucial for understanding the dynamics and stability of power systems with multiple synchronous machines. The objective is to solve the swing equations for a network of M machines connected to an N-bus power system.
In analyzing the system, the nodal equations represent the relationship between bus voltages, machine voltages, and machine currents. The nodal equation is given by:
208
Linear time-invariant Systems01:23

Linear time-invariant Systems

303
A system is linear if it displays the characteristics of homogeneity and additivity, together termed the superposition property. This principle is fundamental in all linear systems. Linear time-invariant (LTI) systems include systems with linear elements and constant parameters.
The input-output behavior of an LTI system can be fully defined by its response to an impulsive excitation at its input. Once this impulse response is known, the system's reaction to any other input can be...
303
Relative Motion Analysis using Rotating Axes-Problem Solving01:29

Relative Motion Analysis using Rotating Axes-Problem Solving

428
Consider a crane whose telescopic boom rotates with an angular velocity of 0.04 rad/s and angular acceleration of 0.02 rad/s2. Along with the rotation, the boom also extends linearly with a uniform speed of 5 m/s. The extension of the boom is measured at point D, which is measured with respect to the fixed point C on the other end of the boom. For the given instant, the distance between points C and D is 60 meters.
Here, in order to determine the magnitude of velocity and acceleration for point...
428
Time and frequency -Domain Interpretation of Phase-lag Control01:21

Time and frequency -Domain Interpretation of Phase-lag Control

126
Phase-lag controllers are widely used in control systems to improve stability and reduce steady-state errors. A dimmer switch controlling the brightness of a light bulb serves as a practical example of phase-lag control, gradually adjusting the bulb's brightness. Mathematically, phase-lag control or low-pass filtering is represented when the factor 'a' is less than 1.
Phase-lag controllers do not place a pole at zero, but instead influence the steady-state error by amplifying any...
126
Stability of Equilibrium Configuration: Problem Solving01:13

Stability of Equilibrium Configuration: Problem Solving

636
The stability of equilibrium configurations is an important concept in physics, engineering, and other related fields. In simple terms, it refers to the tendency of an object or system to return to its equilibrium position after being disturbed. The stability of an equilibrium configuration can be analyzed by considering the potential energy function of the system and examining its behavior near the equilibrium point.
Problem-solving in the context of the stability of equilibrium configuration...
636
BIBO stability of continuous and discrete -time systems01:24

BIBO stability of continuous and discrete -time systems

460
System stability is a fundamental concept in signal processing, often assessed using convolution. For a system to be considered bounded-input bounded-output (BIBO) stable, any bounded input signal must produce a bounded output signal. A bounded input signal is one where the modulus does not exceed a certain constant at any point in time.
To determine the BIBO stability, the convolution integral is utilized when a bounded continuous-time input is applied to a Linear Time-Invariant (LTI) system....
460

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Kinetics of foot-and-mouth disease antibody response in cattle vaccinated with FMD-HS-BQ combined vaccine under field condition.

Frontiers in microbiology·2026
Same author

Integrative Proteomic and Lipidomic Analysis of Patients With Acute Myocardial Infarction Treated With PCSK9 Antibodies and Statins.

Circulation. Genomic and precision medicine·2026
Same author

Clinical proteomics in cardiovascular medicine: Current capabilities, limitations, and future directions.

Atherosclerosis·2026
Same author

A bio-inspired sustainable sugar battery integrated with a reversible coordination complex.

Chemical communications (Cambridge, England)·2026
Same author

Precision medicine requires precision proteomics: discordance between proteomic and clinical assays in UK Biobank.

Cardiovascular research·2025
Same author

Parsimonious machine learning model to predict 1-year mortality and procedural futility after transcatheter aortic valve replacement.

Heart (British Cardiac Society)·2025
Same journal

RETRACTED: Zhang et al. A Novel Framework for Reconstruction and Imaging of Target Scattering Centers via Wide-Angle Incidence in Radar Networks. <i>Sensors</i> 2025, <i>25</i>, 6802.

Sensors (Basel, Switzerland)·2026
Same journal

Enhancing Unsupervised Multi-Source Domain Adaptation for Person Re-Identification via Mixture of Experts and Graph-Based Relation.

Sensors (Basel, Switzerland)·2026
Same journal

Development of an Instrumented Glove for Palmar Pressure Assessment in Kayakers.

Sensors (Basel, Switzerland)·2026
Same journal

Development and Experimental Validation of an Autonomous IoT-Based Monitoring System for Real-Time Water Quality Assessment in the Amazon River.

Sensors (Basel, Switzerland)·2026
Same journal

Semi-Supervised Adversarial Learning Framework for Controller Area Network Bus Intrusion Detection.

Sensors (Basel, Switzerland)·2026
Same journal

Smart Optimization Method for Safety Signs in Innovative Manufacturing Environments Integrating Industrial Field IoT Sensors and Knowledge Graphs.

Sensors (Basel, Switzerland)·2026
See all related articles

Related Experiment Video

Updated: Aug 1, 2025

Assessing the Multiple Dimensions of Engagement to Characterize Learning: A Neurophysiological Perspective
13:57

Assessing the Multiple Dimensions of Engagement to Characterize Learning: A Neurophysiological Perspective

Published on: July 1, 2015

12.6K

Predefined Time Synchronization of Multi-Agent Systems: A Passivity Based Analysis.

Vinay Pandey1, Eram Taslima1, Bhawana Singh2

  • 1Department of Electrical Engineering, Indian Institute of Technology (BHU), Varanasi 221005, India.

Sensors (Basel, Switzerland)
|April 28, 2023
PubMed
Summary
This summary is machine-generated.

This study introduces a new control method for predefined-time synchronization in nonlinear multi-agent systems. The approach ensures systems synchronize within a pre-set time, outperforming existing finite-time methods.

Keywords:
finite-time stabilitymulti-agent systemspassivitypredefined-time stability

More Related Videos

Real-Time Proxy-Control of Re-Parameterized Peripheral Signals using a Close-Loop Interface
11:54

Real-Time Proxy-Control of Re-Parameterized Peripheral Signals using a Close-Loop Interface

Published on: May 8, 2021

4.5K
Bouncing Ball with a Uniformly Varying Velocity in a Metronome Synchronization Task
05:04

Bouncing Ball with a Uniformly Varying Velocity in a Metronome Synchronization Task

Published on: September 21, 2017

6.0K

Related Experiment Videos

Last Updated: Aug 1, 2025

Assessing the Multiple Dimensions of Engagement to Characterize Learning: A Neurophysiological Perspective
13:57

Assessing the Multiple Dimensions of Engagement to Characterize Learning: A Neurophysiological Perspective

Published on: July 1, 2015

12.6K
Real-Time Proxy-Control of Re-Parameterized Peripheral Signals using a Close-Loop Interface
11:54

Real-Time Proxy-Control of Re-Parameterized Peripheral Signals using a Close-Loop Interface

Published on: May 8, 2021

4.5K
Bouncing Ball with a Uniformly Varying Velocity in a Metronome Synchronization Task
05:04

Bouncing Ball with a Uniformly Varying Velocity in a Metronome Synchronization Task

Published on: September 21, 2017

6.0K

Area of Science:

  • Control Theory
  • Nonlinear Systems
  • Multi-Agent Systems

Background:

  • Designing controllers for nonlinear multi-agent systems requires robust stability analysis.
  • Existing synchronization methods often lack precise time control.

Purpose of the Study:

  • To develop a control framework for predefined-time synchronization in nonlinear multi-agent systems.
  • To introduce and utilize the concept of predefined-time passivity for controller design.

Main Methods:

  • Exploiting the notion of passivity to design controllers.
  • Developing static and adaptive predefined-time control algorithms.
  • Mathematical analysis including convergence and stability proofs.

Main Results:

  • Designed controllers ensure synchronization in a pre-assigned time for nonlinear multi-agent systems.
  • Demonstrated effectiveness for large-scale and higher-order systems.
  • Applied the framework to Chua's circuit and compared with finite-time synchronization for the Kuramoto model.

Conclusions:

  • The proposed predefined-time synchronization framework is effective for nonlinear multi-agent systems.
  • Passivity-based control offers a powerful approach for achieving predictable synchronization times.
  • The method provides a significant advancement over existing finite-time synchronization techniques.