Guinea pig 33-amino acid gastrin

Area of Science:

• Biochemistry
• Peptide Chemistry
• Comparative Endocrinology

Background:

• Gastrin is a key gastrointestinal hormone regulating gastric acid secretion.
• Previous research identified gastrin precursors in pigs and humans, but limited data exists for other species.
• The larger molecular form of gastrin, known as big gastrin, is typically a minor component in most species.

Purpose of the Study:

• To purify and determine the amino acid sequence of big gastrin from guinea pig (GP) antra.
• To compare the structure of GP big gastrin with known gastrin precursors from other species.

Main Methods:

• Extraction of big gastrin from defatted guinea pig antra using ammonium bicarbonate.
• Purification using QA-52 anion exchange cellulose and high-performance liquid chromatography (HPLC) on a mu Bondapak C18 cartridge.
• Amino acid sequencing of the purified peptide.

Main Results:

• Successfully purified 3.6 nmol of big gastrin from 200g of guinea pig antra.
• Determined the amino acid sequence of GP big gastrin as a 33 amino acid peptide: ELGPQVPAHLRTDLSKKQGPWAEEEAAYGWMDF.
• Identified significant structural differences compared to pig G34, including variations in the N-terminus and a C-terminal deletion.

Conclusions:

• The study reports the first purification and sequencing of guinea pig big gastrin.
• The structural analysis reveals species-specific variations in gastrin precursor evolution.
• This work contributes to a better understanding of gastrin heterogeneity and its implications in comparative physiology.