Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

Antiasthma Drugs: Mast Cell Stabilizers and Anti-IgE Drugs01:25

Antiasthma Drugs: Mast Cell Stabilizers and Anti-IgE Drugs

237
Asthma is a chronic respiratory condition for which new therapeutic avenues, including anti-inflammatory drugs like mast cell stabilizers and anti-IgE treatments, continue to be developed.
Mast cell stabilizers, such as cromolyn (also known as sodium cromoglycate) and nedocromil (Tilade), are effective drugs in asthma management. These stabilizers hinder histamine release by skillfully obstructing the activation of mast cells and other cellular entities. Notably, they navigate this task without...
237
Antiasthma Drugs: Leukotriene Modifiers01:19

Antiasthma Drugs: Leukotriene Modifiers

245
Leukotriene modifiers, or cysteinyl leukotriene receptor antagonists, are medications used to manage chronic asthma. These agents target specific inflammatory mediators produced during arachidonic acid metabolism, an essential process in generating inflammation in the body.
Leukotriene modifiers work through two distinct mechanisms:
245
Upper Respiratory Drugs: Antitussives, Expectorants, and Mucolytics01:23

Upper Respiratory Drugs: Antitussives, Expectorants, and Mucolytics

232
Respiratory symptoms, such as congestion and cough, commonly accompany respiratory tract conditions. Various medications, such as antitussives, expectorants, and mucolytics, play crucial roles in providing relief.
Antitussives include codeine, dextromethorphan (Robitussin), and benzonatate (Tessalon). Codeine and dextromethorphan exert their effects centrally by suppressing the cough reflex center in the medulla.  Benzonatate operates peripherally within the respiratory tract by...
232
Blood Transfusion and Agglutination02:45

Blood Transfusion and Agglutination

10.7K
Blood transfusion is a therapeutic measure to restore the blood volume after extensive blood loss due to an accident or a medical procedure. Blood transfusion involves drawing a certain amount of blood from a suitable donor and infusing it into the recipient.
History
The history of blood transfusion dates back to the 17th century, when early attempts were made in animals. In 1818 James Blundell, a British doctor, performed the first successful human blood transfusion. Later in 1900, Karl...
10.7K
Cross-reactivity00:42

Cross-reactivity

31.0K
Overview
31.0K
Radiological Investigation I: X-ray and CT01:30

Radiological Investigation I: X-ray and CT

214
Radiological investigations, including X-rays and computed tomography (CT) scans, are critical for diagnosing and evaluating various medical conditions. These imaging techniques provide valuable insights into the body's internal structures, aiding in the detection of abnormalities, assessment of disease progression, and development of treatment strategies. This article delves into two primary radiological investigations, chest X-rays and CT scans, outlining their purpose, procedures, and...
214

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Exploratory investigation of changes in blood transcriptome following mepolizumab treatment for asthma.

Frontiers in immunology·2026
Same author

Emerging perspectives in respiratory allergic diseases: a review of future directions.

Frontiers in allergy·2026
Same author

Assessing real-world natural history of indolent systemic mastocytosis: A retrospective matched cohort study.

The journal of allergy and clinical immunology. Global·2026
Same author

Proceedings From the Minnesota Learning Health Systems Symposium: The Role of Academic Partnership and (De)Implementation Science.

Mayo Clinic proceedings·2026
Same author

Avapritinib achieves long-term disease control with favorable safety in patients with indolent systemic mastocytosis over 3 years.

The Journal of allergy and clinical immunology·2026
Same author

Beyond Rurality: Individual Socioeconomic Status and Chronic Disease Prevalence.

medRxiv : the preprint server for health sciences·2026

Related Experiment Video

Updated: Jun 7, 2025

Immunization of Alpacas Lama pacos with Protein Antigens and Production of Antigen-specific Single Domain Antibodies
05:27

Immunization of Alpacas Lama pacos with Protein Antigens and Production of Antigen-specific Single Domain Antibodies

Published on: January 26, 2019

23.5K

Omalizumab safety concerns.

Thanai Pongdee1, James T Li1

  • 1Division of Allergic Diseases, Mayo Clinic, Rochester, Minn.

The Journal of Allergy and Clinical Immunology
|November 14, 2024
PubMed
Summary

Omalizumab, an anti-IgE therapy, is approved for allergic asthma, chronic urticaria, and other conditions. This review examines its safety profile, including anaphylaxis, pregnancy, malignancy, cardiovascular events, and infections, to aid treatment decisions.

Keywords:
Omalizumabanaphylaxiscardiovascularinfectionmalignancypregnancyrisksafety

More Related Videos

Assessment of Chimeric Antigen Receptor T Cell-Associated Toxicities Using an Acute Lymphoblastic Leukemia Patient-Derived Xenograft Mouse Model
06:08

Assessment of Chimeric Antigen Receptor T Cell-Associated Toxicities Using an Acute Lymphoblastic Leukemia Patient-Derived Xenograft Mouse Model

Published on: February 10, 2023

1.3K
Murine Model of Allergen Induced Asthma
08:05

Murine Model of Allergen Induced Asthma

Published on: May 14, 2012

40.2K

Related Experiment Videos

Last Updated: Jun 7, 2025

Immunization of Alpacas Lama pacos with Protein Antigens and Production of Antigen-specific Single Domain Antibodies
05:27

Immunization of Alpacas Lama pacos with Protein Antigens and Production of Antigen-specific Single Domain Antibodies

Published on: January 26, 2019

23.5K
Assessment of Chimeric Antigen Receptor T Cell-Associated Toxicities Using an Acute Lymphoblastic Leukemia Patient-Derived Xenograft Mouse Model
06:08

Assessment of Chimeric Antigen Receptor T Cell-Associated Toxicities Using an Acute Lymphoblastic Leukemia Patient-Derived Xenograft Mouse Model

Published on: February 10, 2023

1.3K
Murine Model of Allergen Induced Asthma
08:05

Murine Model of Allergen Induced Asthma

Published on: May 14, 2012

40.2K

Area of Science:

  • Immunology
  • Pharmacology
  • Allergology

Background:

  • Immunoglobulin E (IgE) and mast cells are central to allergic disease pathophysiology.
  • Omalizumab, the first anti-IgE monoclonal antibody (mAb), was approved in 2003 for allergic asthma.
  • Its indications have expanded to include chronic spontaneous urticaria, chronic rhinosinusitis with nasal polyps, and food allergy.

Purpose of the Study:

  • To review and contextualize the safety data of omalizumab.
  • To assess specific adverse events of interest associated with omalizumab therapy.
  • To provide a resource for shared decision-making regarding omalizumab treatment.

Main Methods:

  • Extensive evaluation of clinical trial data.
  • Analysis of postmarketing surveillance data.
  • Systematic review of safety data for specific adverse events.

Main Results:

  • Omalizumab is generally safe and well-tolerated.
  • Key safety concerns include anaphylaxis, pregnancy, malignancy, cardiovascular events, and infections.
  • Detailed safety profiles for these adverse events have been compiled.

Conclusions:

  • Omalizumab has a well-characterized safety profile across its approved indications.
  • Understanding potential adverse events is crucial for risk-benefit assessment.
  • This review supports informed clinical decision-making for patients considering omalizumab.