Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

Epigenetic Regulation01:37

Epigenetic Regulation

3.1K
Epigenetic changes alter the physical structure of the DNA without changing the genetic sequence and often regulate whether genes are turned on or off. This regulation ensures that each cell produces only proteins necessary for its function. For example, proteins that promote bone growth are not produced in muscle cells. Epigenetic mechanisms play an essential role in healthy development. Conversely, precisely regulated epigenetic mechanisms are disrupted in diseases like cancer.
X-chromosome...
3.1K
Master Transcription Regulators02:23

Master Transcription Regulators

7.0K
Master transcription regulators are regulatory proteins that are predominantly responsible for regulating the expression of multiple genes. Often these genes work in concert to drive a  complex process. Activation of a master transcription regulator can lead to a cascade of transcriptional activation necessary for that outcome. These regulators can directly bind to the regulatory sequences of the various genes involved, or they can indirectly regulate transcription by binding to regulatory...
7.0K
Chromatin Modification in iPS Cells01:32

Chromatin Modification in iPS Cells

1.9K
Chromatin modification alters gene expression; therefore, scientists can add histone-modifying enzymes, histone variants, and chromatin remodeling complexes to somatic cells to aid reprogramming into pluripotent stem (iPS) cells.
Compact chromatin makes reprogramming difficult. Enzymes, such as histone demethylases and acetyltransferases, are often added during reprogramming to loosen the chromatin, making the DNA more accessible to transcription factors. Molecules that inhibit histone...
1.9K
Phase II Reactions: Methylation Reactions01:17

Phase II Reactions: Methylation Reactions

340
Methylation is a phase II biotransformation process involving the attachment of a methyl group to a substrate. Enzymes known as methyltransferases orchestrate this reaction.
The mechanism of methylation unfolds in two stages. The first stage sees a methyltransferase enzyme facilitating the transfer of a methyl group from S-adenosylmethionine (SAM) to the substrate, forming S-adenosylhomocysteine (SAH). The second stage involves further metabolism of SAH into homocysteine, which can be recycled...
340
Somatic to iPS Cell Reprogramming01:29

Somatic to iPS Cell Reprogramming

2.3K
Reprogramming alters the gene expression in somatic cells, transforming them into induced pluripotent stem (iPS) cells over several generations. Scientists can reprogram cells by introducing genes for four transcription factors—Oct4, Sox2, Klf4, and c-Myc (OSKM) by viral or non-viral methods. These factors are also known as Yamanaka factors after Shinya Yamanaka, who first generated iPS cells using mouse skin cells. Yamanaka was awarded the Nobel Prize in Physiology or Medicine in 2012...
2.3K
Regulation of Expression Occurs at Multiple Steps02:24

Regulation of Expression Occurs at Multiple Steps

23.3K
Gene expression can be regulated at almost every step from gene to protein. Transcription is the step that is most commonly regulated. This involves the binding of proteins to short regulatory sequences on the DNA. This association can either promote or inhibit the transcription of a gene associated with the respective sequence.
Transcription results in the generation of precursor (pre-mRNA) that consists of both exons and introns, which needs further processing before being translated to a...
23.3K

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

STPP: Efficient and Progressive Structured Pruning Via Enhanced Sparsification Paradigm.

IEEE transactions on pattern analysis and machine intelligence·2026
Same author

Prognostic value of tertiary lymphoid structures in high-risk esophageal squamous cell carcinoma following neoadjuvant chemoimmunotherapy.

BMC cancer·2026
Same author

ASO Author Reflections: Can Immunochemotherapy Redefine Neoadjuvant Treatment for Node-Positive Esophageal Squamous Cell Carcinoma?

Annals of surgical oncology·2026
Same author

SGLT2 inhibition attenuates diabetes-induced lipid nephrotoxicity by targeting SOAT1-mediated cholesterol metabolism in proximal tubular cells.

Cellular signalling·2026
Same author

Comparison of multi-track mini single arm external fixation and plate internal fixation in the treatment of missed Monteggia fracture in children.

Frontiers in pediatrics·2026
Same author

A Prospective Multicenter Comparative Cohort Study of Neoadjuvant Sintilimab Plus Chemotherapy and Chemoradiotherapy in Resectable Clinical Node-Positive Esophageal Squamous Cell Carcinoma.

Annals of surgical oncology·2026

Related Experiment Video

Updated: Sep 10, 2025

An Alternative Culture Method to Maintain Genomic Hypomethylation of Mouse Embryonic Stem Cells Using MEK Inhibitor PD0325901 and Vitamin C
11:53

An Alternative Culture Method to Maintain Genomic Hypomethylation of Mouse Embryonic Stem Cells Using MEK Inhibitor PD0325901 and Vitamin C

Published on: June 1, 2018

6.7K

GRK2 Orchestrates VSMC Phenotypic Modulation via DNMT1-Mediated DNA Methylation Reprogramming.

Chao-Hua Kong1, Yue Sun1, Li-da Wu1

  • 1Department of Cardiology, Nanjing First Hospital, Nanjing Medical University, China (C.-h.K., Y.S., L.-d.W., W.-y.Z., D.-c.W., Z.-h.J., X.-m.J., P.Y., Y.G., A.-q.C., Y.-l.C., S.-l.C.).

Arteriosclerosis, Thrombosis, and Vascular Biology
|August 21, 2025
PubMed
Summary

G-protein-coupled receptor kinase 2 (GRK2) epigenetically regulates vascular smooth muscle cell (VSMC) fate. Targeting the GRK2-DNMT1 pathway may offer new treatments for vascular remodeling diseases.

Keywords:
GRKscytokineshyperplasiamethyltransferasephenotype

More Related Videos

Immunostaining for DNA Modifications: Computational Analysis of Confocal Images
09:42

Immunostaining for DNA Modifications: Computational Analysis of Confocal Images

Published on: September 7, 2017

9.8K
Correlating Gene-specific DNA Methylation Changes with Expression and Transcriptional Activity of Astrocytic KCNJ10 Kir4.1
11:19

Correlating Gene-specific DNA Methylation Changes with Expression and Transcriptional Activity of Astrocytic KCNJ10 Kir4.1

Published on: September 26, 2015

8.1K

Related Experiment Videos

Last Updated: Sep 10, 2025

An Alternative Culture Method to Maintain Genomic Hypomethylation of Mouse Embryonic Stem Cells Using MEK Inhibitor PD0325901 and Vitamin C
11:53

An Alternative Culture Method to Maintain Genomic Hypomethylation of Mouse Embryonic Stem Cells Using MEK Inhibitor PD0325901 and Vitamin C

Published on: June 1, 2018

6.7K
Immunostaining for DNA Modifications: Computational Analysis of Confocal Images
09:42

Immunostaining for DNA Modifications: Computational Analysis of Confocal Images

Published on: September 7, 2017

9.8K
Correlating Gene-specific DNA Methylation Changes with Expression and Transcriptional Activity of Astrocytic KCNJ10 Kir4.1
11:19

Correlating Gene-specific DNA Methylation Changes with Expression and Transcriptional Activity of Astrocytic KCNJ10 Kir4.1

Published on: September 26, 2015

8.1K

Area of Science:

  • Vascular biology
  • Epigenetics
  • Molecular mechanisms of cardiovascular disease

Background:

  • Vascular smooth muscle cell (VSMC) phenotypic modulation contributes to arterial diseases.
  • Epigenetic regulation plays a key role in VSMC fate determination.
  • Mechanisms controlling epigenetic regulation in VSMCs are not fully understood.

Purpose of the Study:

  • To identify novel epigenetic regulators of VSMC phenotype.
  • To elucidate the role of GRK2 in VSMC phenotypic switching.
  • To investigate the therapeutic potential of targeting GRK2 in vascular remodeling.

Main Methods:

  • Analysis of mouse aortic smooth muscle cells and a carotid artery injury model.
  • Examination of human atherosclerosis datasets.
  • Genetic and pharmacological manipulation of GRK2 and DNMT1.

Main Results:

  • GRK2 expression is elevated in dedifferentiated VSMCs.
  • GRK2 silencing inhibits VSMC phenotypic switching.
  • GRK2 phosphorylates and stabilizes DNMT1, leading to hypermethylation and reduced contractile protein expression.

Conclusions:

  • The GRK2-DNMT1 signaling axis is a critical regulator of VSMC phenotypic switching.
  • This pathway represents a potential therapeutic target for vascular remodeling.
  • Understanding this axis provides insights into the pathogenesis of arterial diseases.