Related Experiment Video
Updated: Sep 25, 2026

Tissue Triage and Freezing for Models of Skeletal Muscle Disease
Published on: July 15, 2014
Cryoprotective mechanisms of membrane-separated fractions from thawed drip: Insights from a myosin model
Xiaoyu Han1, Yang Li1, Jinxuan Cao1
1Key Laboratory of Geriatric Nutrition and Health (Beijing Technology and Business University), Ministry of Education, 100048 Beijing, China; Beijing Engineering and Technology Research Center of Food Additives, School of Food and Health, Beijing Technology and Business University, 100048 Beijing, China.
Abstract:
This study aimed to investigate cryoprotective activity of thawed drip membrane-separated components (> 10 kDa and < 10 kDa) and their cryoprotective mechanism based on a myosin model. Both fractions exhibited stable hydroxyl structures and strong thermal hysteresis activity, significantly enhancing survival rate of Streptococcus thermophilus under freeze-thaw stress. Using myosin as a model system, both fractions suppressed freezing-induced increases in surface hydrophobicity, carbonyl and particle size, while mitigating decreases in free sulfhydryl and fluorescence intensity, thereby alleviating protein aggregation and conformational denaturation. Intermolecular force and molecular docking analyses revealed that >10 kDa fraction interacted with myosin mainly through non-specific binding, while the peptide KELASQPDVDGFLVGGASLKPEFVDIINAK in <10 kDa fraction bound to key myosin domains via hydrogen bonding and hydrophobic interactions. These findings offer new insights for developing natural cryoprotectants to enhance quality stability of frozen food products.
More Related Videos
Related Concept Videos
Membrane Fluidity
Cryo-electron Microscopy

