Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Experiment Videos

Rabbit pancreatic polypeptide

N J Marks1, C Shaw, D W Halton

  • 1School of Clinical Medicine, Queen's University of Belfast, Northern Ireland.

Comparative Biochemistry and Physiology. B, Comparative Biochemistry
|December 1, 1993
PubMed
Summary
This summary is machine-generated.

Related Concept Videos

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Source variability and atmospheric processing of NH<sub>x</sub> using δ<sup>15</sup>N: Linkages with WSOC fluorescence indices.

Environmental pollution (Barking, Essex : 1987)·2026
Same author

Mortise Ankle X-Rays in Surgical Planning and Post-op Recovery.

Irish medical journal·2023
Same author

Peritoneal mesothelioma presenting with 'kissing' liver metastases.

Annals of the Royal College of Surgeons of England·2021
Same author

COVID-19 in Kidney Transplant Patients From a Large UK Transplant Center: Exploring Risk Factors for Disease Severity.

Transplantation proceedings·2021
Same author

The evolving role of surface electromyography in amyotrophic lateral sclerosis: A systematic review.

Clinical neurophysiology : official journal of the International Federation of Clinical Neurophysiology·2020
Same author

Corrigendum to 'SPiQE: An automated analytical tool for detecting and characterising fasciculations in amyotrophic lateral sclerosis' [Clin. Neurophysiol. 130 (2019) 1083-1090].

Clinical neurophysiology : official journal of the International Federation of Clinical Neurophysiology·2019
Same journal

RETINOID METABOLISM AND CONVERSION OF RETINOL TO DEHYDRORETINOL IN THE CRAYFISH (<i>PROCAMBARUS CLARKII</i>) RETINA.

Comparative biochemistry and physiology. B, Comparative biochemistry·2015
Same journal

Distribution of taurine and other free amino acids in the visual pathway of the crayfish procambarus clarkii.

Comparative biochemistry and physiology. B, Comparative biochemistry·2013
Same journal

Comparative study of free and membrane-bound acidic beta-D-glucosidase from the hepatopancreas of the shrimp Penaeus japonicus (Crustacea: decapoda).

Comparative biochemistry and physiology. B, Comparative biochemistry·2010
Same journal

Purification and characterization of an alpha-glucosidase from the hepatopancreas of the shrimp Penaeus japonicus (Crustacea: decapoda).

Comparative biochemistry and physiology. B, Comparative biochemistry·2010
Same journal

A neutral beta-galactosidase from the hepatopancreas of the shrimp Penaeus monodon (Crustacea: Decapoda): dimeric and sialyated.

Comparative biochemistry and physiology. B, Comparative biochemistry·2010
Same journal

Purification and properties of a beta-mannosidase from shrimp (Penaeus japonicus) hepatopancreas.

Comparative biochemistry and physiology. B, Comparative biochemistry·2010
See all related articles

Researchers determined the primary structure of rabbit pancreatic polypeptide (PP), a crucial regulatory peptide. This finding aids in understanding peptide localization and quantification in various biological studies.

Area of Science:

  • Biochemistry
  • Peptide Chemistry

Background:

  • Specific antisera in rabbits are essential for regulatory peptide studies.
  • The primary structure of rabbit pancreatic polypeptide (PP) was previously unknown.

Purpose of the Study:

  • To determine the full primary structure of PP isolated from rabbit pancreas.
  • To provide a reference sequence for future research on rabbit PP.

Main Methods:

  • Purification of PP immunoreactivity using a specific antiserum.
  • Automated Edman degradation for sequence determination.
  • Mass spectrometry for molecular mass confirmation.

Main Results:

  • The full primary structure of rabbit PP was elucidated as APPEPVYPGDDATPEQMAEYVADLRRYINMLTRPRY.

Related Experiment Videos

  • The molecular mass was confirmed at 4196 Da.
  • Rabbit PP exhibits three unique substitutions compared to other mammalian PP sequences.

    • Conclusions:

    • The primary structure of rabbit PP has been definitively determined.
    • This structural information is vital for studies involving rabbit PP localization and quantification.
    • Rabbit PP's unique sequence may have implications for its biological function.