Related Experiment Video
Updated: Mar 13, 2026
Laboratory Techniques Used to Maintain and Differentiate Biotypes of Vibrio cholerae Clinical and Environmental Isolates
Published on: May 30, 2017
In silico identification of outer membrane protein (Omp) and subunit vaccine design against pathogenic Vibrio
Pradipta Ranjan Rauta1, Sarbani Ashe1, Debasis Nayak1
1Immunology and Molecular Medicine Laboratory, Department of Life Science, National Institute of Technology, Rourkela, Odisha, 769008 India.
Abstract:
Virulence-related outer membrane proteins (Omps) are expressed in bacteria (Gram-negative) such as V. cholerae and are vital to bacterial invasion in to eukaryotic cell and survival within macrophages that could be best candidate for development of vaccine against V. cholerae. Applying in silico approaches, the 3-D model of the Omp was developed using Swiss model server and validated byProSA and Procheck web server. The continuous stretch of amino acid sequences 26mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds. Further, the selected antigenic sequences (having B-cell epitopes) were analyzed for T-cell epitopes (MHC I and MHC II alleles binding sequence) by using ProPred 1 and ProPred respectively. The epitope (9mer: YKSISPQDA) that binds to both the MHC classes (MHC I and MHC II) and covers maximum MHC alleles were identified. The identified epitopes can be useful in designing comprehensive peptide vaccine development against V. cholerae by inducing optimal immune response.
Insights
Developing a vaccine against V. cholerae, this study identified key outer membrane protein (Omp) epitopes. These B-cell and T-cell binding sites are crucial for designing effective peptide vaccines against cholera.
Area of Science:
- Bacteriology
- Immunology
- Vaccine Development
Background:
- Outer membrane proteins (Omps) of Gram-negative bacteria like V. cholerae are crucial for virulence and survival.
- These Omps are potential targets for developing vaccines against V. cholerae infections.
Purpose of the Study:
- To identify specific B-cell and T-cell epitopes on V. cholerae Omps using in silico methods.
- To evaluate the potential of these epitopes for comprehensive peptide vaccine design.
Main Methods:
- In silico 3-D modeling of Omp using Swiss model server and validation via ProSA and Procheck.
- Prediction of B-cell epitopes using BCPreds (BCPred and AAP modules).
- Identification of T-cell epitopes (MHC I and MHC II binding) using ProPred 1 and ProPred, focusing on broad MHC allele coverage.
Main Results:
- Selected 26mer and 31mer amino acid sequences with B-cell binding sites.
- Identified a 9mer epitope (YKSISPQDA) that binds to both MHC I and MHC II alleles.
- This epitope covers a maximum number of MHC alleles, indicating broad immunogenicity potential.
Conclusions:
- The identified epitopes are promising candidates for developing a comprehensive peptide vaccine against V. cholerae.
- These epitopes can potentially induce an optimal immune response for effective cholera prevention.
