Related Experiment Video

Updated: Oct 19, 2025

Methodology for Establishing a Community-Wide Life Laboratory for Capturing Unobtrusive and Continuous Remote Activity and Health Data
11:21

Methodology for Establishing a Community-Wide Life Laboratory for Capturing Unobtrusive and Continuous Remote Activity and Health Data

Published on: July 27, 2018

8.4K

Healthy Aging Biomarkers: The INSPIRE's Contribution

I Ader1, L Pénicaud, S Andrieu

  • 1Louis Casteilla, RESTORE, UMR 1301-Inserm 5070 Etablissement Français du Sang-Occitanie (EFS), Inserm 1031, University of Toulouse III, National Veterinary School of Toulouse (ENVT), CNRS, Toulouse, France; louis.casteilla@inserm.fr.

The Journal of Frailty & Aging
|September 22, 2021
PubMed

Keywords:
Biomarkersdependencefrailtyhealthy aging

More Related Videos

Exergaming in Older People Living with HIV Improves Balance, Mobility and Ameliorates Some Aspects of Frailty07:27

Exergaming in Older People Living with HIV Improves Balance, Mobility and Ameliorates Some Aspects of Frailty

Published on: October 6, 2016

10.4K
Surveying Low-Cost Methods to Measure Lifespan and Healthspan in Caenorhabditis elegans10:08

Surveying Low-Cost Methods to Measure Lifespan and Healthspan in Caenorhabditis elegans

Published on: May 18, 2022

3.6K

Related Concept Videos

The Effect of Aging on Tissues01:19

The Effect of Aging on Tissues

Several body functions deteriorate with age. The external signs of aging are easily identifiable. For example, the skin becomes dry, less elastic, and thins out, forming wrinkles. The skin of the face begins to appear looser due to a decrease in the levels of elastic and collagen fibers in the connective tissue. Additionally, melanin production in the hair follicle decreases with age, resulting in gray hair. Moreover, the senses of sight and hearing decline, so glasses and hearing aids may...
2.9K
Aging01:26

Aging

Aging is a complex biological phenomenon influenced by various processes that affect cellular and systemic functions. Several prominent theories attempt to explain its mechanisms, highlighting cellular limitations, oxidative damage, and hormonal changes as central factors in aging.
Cellular Clock Theory
The cellular clock theory posits that the human lifespan is closely tied to the finite capacity of cells to divide, a phenomenon governed by telomeres, which are protective caps at the ends of...
336
Mitochondria01:37

Mitochondria

Mitochondria are eukaryotic cellular organelles that are known to produce energy through a process called oxidative phosphorylation. Besides their primary function, mitochondria are involved in various cellular processes, including cell growth, differentiation, signaling, metabolism, and senescence. Age-related changes cause a decline in mitochondrial quality and integrity due to increased mitochondrial mutations and oxidative damage. Thus, aging can severely impact mitochondrial functions,...
15.8K
Lifestyle Factors and Health01:20

Lifestyle Factors and Health

Lifestyle factors play a critical role in maintaining overall health and preventing chronic diseases. Key elements, such as regular physical activity, a nutritious diet, and abstinence from smoking, can significantly enhance physical, mental, and emotional well-being while reducing the risk of several life-threatening conditions.
Benefits of Physical Activity
Physical activity, whether through structured exercise or casual activities like walking, biking, or dancing, is a cornerstone of a...
229
Whole Body Regeneration01:33

Whole Body Regeneration

Regeneration is the process of restoring injured or lost tissues, organs, or body parts. While simpler organisms generally show greater ability to regenerate their whole body, few complex animals show similarly exceptional regeneration. For example, planarian flatworms have a unique regenerative potential making them a popular study organism among biologists to understand the mechanisms of whole body regeneration. Other organisms, such as hydra, also show extreme regeneration potential;...
3.6K