Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

The Effect of Aging on Tissues01:19

The Effect of Aging on Tissues

2.9K
Several body functions deteriorate with age. The external signs of aging are easily identifiable. For example, the skin becomes dry, less elastic, and thins out, forming wrinkles. The skin of the face begins to appear looser due to a decrease in the levels of elastic and collagen fibers in the connective tissue. Additionally, melanin production in the hair follicle decreases with age, resulting in gray hair. Moreover, the senses of sight and hearing decline, so glasses and hearing aids may...
2.9K
Aging01:26

Aging

336
Aging is a complex biological phenomenon influenced by various processes that affect cellular and systemic functions. Several prominent theories attempt to explain its mechanisms, highlighting cellular limitations, oxidative damage, and hormonal changes as central factors in aging.
Cellular Clock Theory
The cellular clock theory posits that the human lifespan is closely tied to the finite capacity of cells to divide, a phenomenon governed by telomeres, which are protective caps at the ends of...
336
Mitochondria01:37

Mitochondria

15.8K
Mitochondria are eukaryotic cellular organelles that are known to produce energy through a process called oxidative phosphorylation. Besides their primary function, mitochondria are involved in various cellular processes, including cell growth, differentiation, signaling, metabolism, and senescence. Age-related changes cause a decline in mitochondrial quality and integrity due to increased mitochondrial mutations and oxidative damage. Thus, aging can severely impact mitochondrial functions,...
15.8K
Lifestyle Factors and Health01:20

Lifestyle Factors and Health

229
Lifestyle factors play a critical role in maintaining overall health and preventing chronic diseases. Key elements, such as regular physical activity, a nutritious diet, and abstinence from smoking, can significantly enhance physical, mental, and emotional well-being while reducing the risk of several life-threatening conditions.
Benefits of Physical Activity
Physical activity, whether through structured exercise or casual activities like walking, biking, or dancing, is a cornerstone of a...
229
Whole Body Regeneration01:33

Whole Body Regeneration

3.6K
Regeneration is the process of restoring injured or lost tissues, organs, or body parts. While simpler organisms generally show greater ability to regenerate their whole body, few complex animals show similarly exceptional regeneration. For example, planarian flatworms have a unique regenerative potential making them a popular study organism among biologists to understand the mechanisms of whole body regeneration. Other organisms, such as hydra, also show extreme regeneration potential;...
3.6K

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Identification of Prominin-2 as a new player of cardiomyocyte senescence in the aging heart.

Aging cell·2024
Same author

Plasma Inflammatory Biomarkers and Anorexia of Ageing among Community-Dwelling Older Adults: An Exploratory Analysis of the MAPT Study.

The journal of nutrition, health & aging·2023
Same author

Circulating Levels of Apelin, GDF-15 and Sarcopenia: Lack of Association in the MAPT Study.

The journal of nutrition, health & aging·2022
Same author

International Exercise Recommendations in Older Adults (ICFSR): Expert Consensus Guidelines.

The journal of nutrition, health & aging·2021
Same author

Identifying Biomarkers for Biological Age: Geroscience and the ICFSR Task Force.

The Journal of frailty & aging·2021
Same author

New Hope for Alzheimer's Disease.

The journal of prevention of Alzheimer's disease·2021
Same journal

From health literacy to capacity preservation: advancing the next step in midlife frailty prevention.

The Journal of frailty & aging·2026
Same journal

An OLD DOG teaching us new tricks in ageing biology.

The Journal of frailty & aging·2026
Same journal

"This has no flavor": balancing nutrition, taste, and salt restriction in geriatric care units.

The Journal of frailty & aging·2026
Same journal

Screening of intrinsic capacity impairment in community-dwelling older adults in Cameroon: A national cross-sectional study.

The Journal of frailty & aging·2026
Same journal

Comparing two methods to quantify physical resilience.

The Journal of frailty & aging·2026
Same journal

Phenotypes of frailty and their mortality and disability implications.

The Journal of frailty & aging·2026
See all related articles

Related Experiment Video

Updated: Oct 19, 2025

Methodology for Establishing a Community-Wide Life Laboratory for Capturing Unobtrusive and Continuous Remote Activity and Health Data
11:21

Methodology for Establishing a Community-Wide Life Laboratory for Capturing Unobtrusive and Continuous Remote Activity and Health Data

Published on: July 27, 2018

8.4K

Healthy Aging Biomarkers: The INSPIRE's Contribution.

I Ader1, L Pénicaud, S Andrieu

  • 1Louis Casteilla, RESTORE, UMR 1301-Inserm 5070 Etablissement Français du Sang-Occitanie (EFS), Inserm 1031, University of Toulouse III, National Veterinary School of Toulouse (ENVT), CNRS, Toulouse, France; louis.casteilla@inserm.fr.

The Journal of Frailty & Aging
|September 22, 2021
PubMed
Summary
This summary is machine-generated.

Optimizing healthy aging requires a new approach focusing on the stroma, immune system, and metabolism, not just parenchymal cells. This can lead to biomarkers predicting frailty and care needs.

Keywords:
Biomarkersdependencefrailtyhealthy aging

More Related Videos

Exergaming in Older People Living with HIV Improves Balance, Mobility and Ameliorates Some Aspects of Frailty
07:27

Exergaming in Older People Living with HIV Improves Balance, Mobility and Ameliorates Some Aspects of Frailty

Published on: October 6, 2016

10.4K
Surveying Low-Cost Methods to Measure Lifespan and Healthspan in Caenorhabditis elegans
10:08

Surveying Low-Cost Methods to Measure Lifespan and Healthspan in Caenorhabditis elegans

Published on: May 18, 2022

3.6K

Related Experiment Videos

Last Updated: Oct 19, 2025

Methodology for Establishing a Community-Wide Life Laboratory for Capturing Unobtrusive and Continuous Remote Activity and Health Data
11:21

Methodology for Establishing a Community-Wide Life Laboratory for Capturing Unobtrusive and Continuous Remote Activity and Health Data

Published on: July 27, 2018

8.4K
Exergaming in Older People Living with HIV Improves Balance, Mobility and Ameliorates Some Aspects of Frailty
07:27

Exergaming in Older People Living with HIV Improves Balance, Mobility and Ameliorates Some Aspects of Frailty

Published on: October 6, 2016

10.4K
Surveying Low-Cost Methods to Measure Lifespan and Healthspan in Caenorhabditis elegans
10:08

Surveying Low-Cost Methods to Measure Lifespan and Healthspan in Caenorhabditis elegans

Published on: May 18, 2022

3.6K

Area of Science:

  • Gerontology and Regenerative Medicine
  • Integrative Physiology
  • Biomarker Discovery

Background:

  • Global challenge to optimize healthy aging and extend health span, as prioritized by the World Health Organization (WHO).
  • Current aging research predominantly focuses on parenchymal cells, neglecting other crucial components.
  • Need for an integrative global strategy combining longitudinal and experimental cohorts with a novel understanding of physiological functioning.

Purpose of the Study:

  • To propose a novel healthcare model prioritizing the maintenance of optimal functional levels.
  • To address the gap in integrative strategies for understanding and optimizing healthy aging.
  • To identify key elements determining age-related functional decline.

Main Methods:

  • Implementing an integrative global strategy within INSPIRE projects.
  • Analyzing physiological functioning through a combination of longitudinal and experimental cohorts.
  • Adopting an innovative transverse understanding of aging processes.

Main Results:

  • Age-related loss of function is proposed to be determined by the stroma, immune system, and metabolism.
  • These three elements form the supportive ground for parenchymal cells.
  • The INSPIRE strategy aims to develop a composite biomarker for predicting capacity changes.

Conclusions:

  • A shift in aging research towards the stroma, immune system, and metabolism is crucial.
  • Development of a composite biomarker can predict changes in functional capacity across the lifespan.
  • Identifying thresholds for frailty and care dependence is a key outcome.