Related Experiment Video

Updated: Sep 11, 2025

Surgical Techniques to Optimize Ovarian Reserve during Laparoscopic Cystectomy for Ovarian Endometrioma
11:29

Surgical Techniques to Optimize Ovarian Reserve during Laparoscopic Cystectomy for Ovarian Endometrioma

Published on: January 22, 2022

14.4K

Anti-cancer Drugs in Endometriosis Management: Mechanisms and Therapeutic Potential

Marzieh Neykhonji1, Abdulridha Mohammed Al-Asady2,3,4, Hanieh Akbarzadeh1

  • 1Department of Clinical Biochemistry, Faculty of Medicine, Mashhad University of Medical Sciences, Mashhad, Iran.

Current Pharmaceutical Design
|August 11, 2025
PubMed
Abstract

Insights

Anti-cancer drugs show promise for treating endometriosis, a condition sharing cancer-like traits. Further research is needed to optimize dosages and minimize side effects for effective endometriosis management.

Area of Science:

  • Gynecology
  • Oncology
  • Pharmacology

Background:

  • Endometriosis is an estrogen-driven condition affecting women, causing pelvic pain and infertility.
  • It shares five key features with cancer, including uncontrolled growth and tissue invasion.
  • These shared characteristics suggest common therapeutic targets for both diseases.

Purpose of the Study:

  • To review studies on the efficacy and mechanisms of anti-cancer drugs in treating endometriosis.
  • To explore the potential of repurposed anti-cancer agents for endometriosis management.

Main Methods:

  • A comprehensive literature review was performed using Google Scholar and PubMed.
  • Searches included relevant keywords without date limitations up to the end of 2024.
  • Existing research on anti-cancer drugs for endometriosis was thoroughly analyzed.

Main Results:

  • Numerous anti-cancer drugs demonstrate significant therapeutic potential for endometriosis.
  • Evidence from cellular, animal, and clinical studies supports these findings.
  • These drugs target pathways relevant to endometriosis, similar to their action in cancer treatment.

Conclusions:

  • Anti-cancer drugs show promise for endometriosis treatment but require further investigation.
  • Research should focus on optimizing drug dosages and regimens to balance efficacy and minimize side effects.
  • Personalized treatment strategies based on disease severity are crucial for effective endometriosis management.
Keywords:
Endometriosisestrogeninfertilitymalignancypelvic painproliferationtumor

More Related Videos

Mouse Model of Surgically-induced Endometriosis by Auto-transplantation of Uterine Tissue08:02

Mouse Model of Surgically-induced Endometriosis by Auto-transplantation of Uterine Tissue

Published on: January 6, 2012

29.0K
Establishment of an Experimental Mouse Model of Endometrioma to Study its Related Infertility08:07

Establishment of an Experimental Mouse Model of Endometrioma to Study its Related Infertility

Published on: April 5, 2024

992

Related Concept Videos

Targeted Cancer Therapies02:57

Targeted Cancer Therapies

The targeted cancer therapies, also known as “molecular targeted therapies,” take advantage of the molecular and genetic differences between the cancer cells and the normal cells. It needs a thorough understanding of the cancer cells to develop drugs that can target specific molecular aspects that drive the growth, progression, and spread of cancer cells without affecting the growth and survival of other normal cells in the body.
There are several types of targeted therapies against...
7.8K
Mitogens and the Cell Cycle02:38

Mitogens and the Cell Cycle

Mitogens and their receptors play a crucial role in controlling the progression of the cell cycle. However, the loss of mitogenic control over cell division leads to tumor formation. Therefore, mitogens and mitogen receptors play an important role in cancer research. For instance, the epidermal growth factor (EGF) - a type of mitogen and its transmembrane receptor (EGFR), decides the fate of the cell's proliferation. When EGF binds to EGFR, a member of the ErbB family of tyrosine kinase...
6.7K
Drugs that Stabilize Microtubules01:15

Drugs that Stabilize Microtubules

Microtubules are dynamic structures that undergo cycles of catastrophe and rescue. The microtubules play a central role in cell division by forming the spindle apparatus for segregating the chromosomes. This makes them ideal targets for regulating dividing cells in tumors and malignant cancer cells. Microtubule stabilizing drugs help stabilize the microtubule formation and promote its polymerization. Paclitaxel was the first microtubule stabilizing agent used as anticancer drug in chemotherapy...
2.1K
Drugs that Destabilize Microtubules01:10

Drugs that Destabilize Microtubules

Microtubules are dynamic structures and can be regulated by microtubule targeting agents (MTAs). Microtubule destabilizing drugs are a class of MTAs that destabilize and prevent microtubules' polymerization. Both natural and synthetic chemicals can be found under this class of drugs. Vincristine and vinblastine, two vinca alkaloids, and colchicine were among the first to be discovered. These drugs can affect cells in various ways, either by inducing a change in cell morphology, preventing...
2.0K
Treatment Resistant Cancers02:56

Treatment Resistant Cancers

Cancer is the second leading cause of death in the United States. A cancer cell is genetically unstable and hence can mutate faster. They can also modify their microenvironment and escape immune surveillance. The difficulties in treating cancer are further compounded by the emergence of rapid resistance to anticancer drugs. The most common ways to attain resistance in cancer cells include alteration in drug transport and metabolism, modification of drug target, elevated DNA damage response, or...
3.4K
The Tumor Microenvironment02:17

The Tumor Microenvironment

Every normal cell or tissue is embedded in a complex local environment called stroma, consisting of different cell types, a basal membrane, and blood vessels. As normal cells mutate and develop into cancer cells, their local environment also changes to allow cancer progression. The tumor microenvironment (TME) consists of a complex cellular matrix of stromal cells and the developing tumor. The cross-talk between cancer cells and surrounding stromal cells is critical to disrupt normal tissue...
6.8K