Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

Ferromagnetism01:31

Ferromagnetism

2.9K
Materials like iron, nickel, and cobalt consist of magnetic domains, within which the magnetic dipoles are arranged parallel to each other. The magnetic dipoles are rigidly aligned in the same direction within a domain by quantum mechanical coupling among the atoms. This coupling is so strong that even thermal agitation at room temperature cannot break it. The result is that each domain has a net dipole moment. However, some materials have weaker coupling, and are ferromagnetic at lower...
2.9K
Types Of Superconductors01:28

Types Of Superconductors

1.6K
A superconductor is a substance that offers zero resistance to the electric current when it drops below a critical temperature. Zero resistance is not the only interesting phenomenon as materials reach their transition temperatures. A second effect is the exclusion of magnetic fields. This is known as the Meissner effect. A light, permanent magnet placed over a superconducting sample will levitate in a stable position above the superconductor. High-speed trains that levitate on strong...
1.6K
Magnetostatic Boundary Conditions01:28

Magnetostatic Boundary Conditions

1.6K
An electric field suffers a discontinuity at a surface charge. Similarly, a magnetic field is discontinuous at a surface current. The perpendicular component of a magnetic field is continuous across the interface of two magnetic mediums. In contrast, its parallel component, perpendicular to the current, is discontinuous by the amount equal to the product of the vacuum permeability and the surface current. Like the scalar potential in electrostatics, the vector potential is also continuous...
1.6K
Valence Bond Theory02:42

Valence Bond Theory

11.2K
Coordination compounds and complexes exhibit different colors, geometries, and magnetic behavior, depending on the metal atom/ion and ligands from which they are composed. In an attempt to explain the bonding and structure of coordination complexes, Linus Pauling proposed the valence bond theory, or VBT, using the concepts of hybridization and the overlapping of the atomic orbitals. According to VBT, the central metal atom or ion (Lewis acid) hybridizes to provide empty orbitals of suitable...
11.2K
Colors and Magnetism03:02

Colors and Magnetism

13.9K
Color in Coordination Complexes
When atoms or molecules absorb light at the proper frequency, their electrons are excited to higher-energy orbitals. For many main group atoms and molecules, the absorbed photons are in the ultraviolet range of the electromagnetic spectrum, which cannot be detected by the human eye. For coordination compounds, the energy difference between the d orbitals often allows photons in the visible range to be absorbed and emitted, which is seen as colors by the human...
13.9K
Paramagnetism01:30

Paramagnetism

3.0K
Paramagnets are materials with unpaired electrons that possess a finite magnetic moment. In the absence of a magnetic field, these moments are randomly oriented, and thus the net moment is zero. Under an external field, a torque acting on the moments tends to align them along the field's direction. However, the random thermal motion of electrons produces a torque opposite to the external field and tries to disorient the moments. These two competing effects align only a few moments along the...
3.0K

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Design of Skyrmion Bags with Tunable Topology in Symmetry-Broken 2D Lattices.

ACS nano·2026
Same author

Cross-attention-based multimodal fusion for early diabetic retinopathy detection.

Scientific reports·2026
Same author

Giant thermal Hall effect in topological magnon insulator Cr<sub>3</sub>Se<sub>4</sub> monolayer.

Materials horizons·2026
Same author

Integrated mRNA-miRNA Transcriptome Analysis Reveals the Molecular Mechanism of Tibetan Sheep Rumen Epithelium Adaptation to High Altitude.

Animals : an open access journal from MDPI·2026
Same author

Magnetically Switchable Ferroelastic Phase Transition in Two-Dimensional Multiferroics.

Small (Weinheim an der Bergstrasse, Germany)·2026
Same author

Pseudo lattice-breathing driven valley switching in 2D ferromagnetic lattices.

Materials horizons·2026

Related Experiment Video

Updated: Jan 13, 2026

Measuring Magnetically-Tuned Ferroelectric Polarization in Liquid Crystals
07:03

Measuring Magnetically-Tuned Ferroelectric Polarization in Liquid Crystals

Published on: August 15, 2018

9.2K

Ferroelectric Switchable Topological Antiferromagnetism.

Wenhui Du1, Kaiying Dou1, Zhonglin He1

  • 1School of Physics, State Key Laboratory of Crystal Materials, Shandong University, Shandanan Street 27, Jinan 250100, China.

Nano Letters
|January 12, 2026
PubMed
Summary
This summary is machine-generated.

Researchers demonstrate ferroelectric switching of topological antiferromagnetism in 2D materials. This breakthrough enables control over exotic spin textures like skyrmions and bimerons, paving the way for advanced spintronic devices.

Keywords:
bimeronferroelectricityfirst-principlesskyrmiontopological antiferromagnetism

More Related Videos

Visualizing Uniaxial-strain Manipulation of Antiferromagnetic Domains in Fe1+YTe Using a Spin-polarized Scanning Tunneling Microscope
09:06

Visualizing Uniaxial-strain Manipulation of Antiferromagnetic Domains in Fe1+YTe Using a Spin-polarized Scanning Tunneling Microscope

Published on: March 24, 2019

8.5K
Electric-field Control of Electronic States in WS2 Nanodevices by Electrolyte Gating
10:36

Electric-field Control of Electronic States in WS2 Nanodevices by Electrolyte Gating

Published on: April 12, 2018

11.9K

Related Experiment Videos

Last Updated: Jan 13, 2026

Measuring Magnetically-Tuned Ferroelectric Polarization in Liquid Crystals
07:03

Measuring Magnetically-Tuned Ferroelectric Polarization in Liquid Crystals

Published on: August 15, 2018

9.2K
Visualizing Uniaxial-strain Manipulation of Antiferromagnetic Domains in Fe1+YTe Using a Spin-polarized Scanning Tunneling Microscope
09:06

Visualizing Uniaxial-strain Manipulation of Antiferromagnetic Domains in Fe1+YTe Using a Spin-polarized Scanning Tunneling Microscope

Published on: March 24, 2019

8.5K
Electric-field Control of Electronic States in WS2 Nanodevices by Electrolyte Gating
10:36

Electric-field Control of Electronic States in WS2 Nanodevices by Electrolyte Gating

Published on: April 12, 2018

11.9K

Area of Science:

  • Condensed Matter Physics
  • Materials Science
  • Spintronics

Background:

  • Topological magnetism, characterized by robust whirling spin textures, is crucial for fundamental research and device applications.
  • Controlling topological magnetism is challenging, especially in antiferromagnetic systems due to their inherent stability.
  • Existing control methods are primarily limited to ferromagnetic systems.

Purpose of the Study:

  • To demonstrate a novel ferroelectric switchable topological antiferromagnetism effect.
  • To establish design principles for achieving this effect in two-dimensional (2D) multiferroics.
  • To explore the potential for precise control of antiferromagnetic spin textures.

Main Methods:

  • Symmetry and model analysis to understand the underlying physics.
  • First-principles calculations.
  • Atomistic spin model simulations.

Main Results:

  • Demonstrated ferroelectric switching of topological antiferromagnetism in 2D multiferroics.
  • Showed that ferroelectric polarization reversal switches antiferromagnetic spin textures between skyrmions and bimerons.
  • Identified the mechanism involving polarization-dependent electronic states and modified single-ion anisotropy.
  • Validated the effect in a AgCr2Te4/In2S3 heterobilayer.

Conclusions:

  • Ferroelectric control of topological antiferromagnetism is feasible in 2D multiferroics.
  • This provides a new pathway for manipulating complex spin textures.
  • Opens avenues for developing novel spintronic devices with switchable topological states.