Jove
Visualize
Contact Us
JoVE
x logofacebook logolinkedin logoyoutube logo
ABOUT JoVE
OverviewLeadershipBlogJoVE Help Center
AUTHORS
Publishing ProcessEditorial BoardScope & PoliciesPeer ReviewFAQSubmit
LIBRARIANS
TestimonialsSubscriptionsAccessResourcesLibrary Advisory BoardFAQ
RESEARCH
JoVE JournalMethods CollectionsJoVE Encyclopedia of ExperimentsArchive
EDUCATION
JoVE CoreJoVE BusinessJoVE Science EducationJoVE Lab ManualFaculty Resource CenterFaculty Site
Terms & Conditions of Use
Privacy Policy
Policies

Related Concept Videos

MOS Capacitor01:25

MOS Capacitor

1.8K
A Metal-Oxide-Semiconductor (MOS) capacitor is a fundamental structure used extensively in semiconductor device technology, particularly in the fabrication of integrated circuits and MOSFETs (metal-oxide-semiconductor field-effect transistors). The MOS capacitor consists of three layers: a metal gate, a dielectric oxide, and a semiconductor substrate.
The metal gate is typically made from highly conductive materials such as aluminum or polysilicon. Beneath the metal gate lies a thin layer of...
1.8K
Long-term Potentiation01:25

Long-term Potentiation

3.8K
Long-term potentiation, or LTP, is one of the ways by which synaptic plasticity—changes in the strength of chemical synapses—can occur in the brain. LTP is the process of synaptic strengthening that occurs over time between pre and postsynaptic neuronal connections. The synaptic strengthening of LTP works in opposition to the synaptic weakening of long-term depression (LTD) and together are the main mechanisms that underlie learning and memory.
Hebbian LTP
LTP can occur when...
3.8K
Long-term Potentiation01:35

Long-term Potentiation

59.5K
Long-term potentiation, or LTP, is one of the ways by which synaptic plasticity—changes in the strength of chemical synapses—can occur in the brain. LTP is the process of synaptic strengthening that occurs over time between pre- and postsynaptic neuronal connections. The synaptic strengthening of LTP works in opposition to the synaptic weakening of long-term depression (LTD) and together are the main mechanisms that underlie learning and memory.
59.5K
MOSFET: Enhancement Mode01:22

MOSFET: Enhancement Mode

1.0K
Enhancement-mode MOSFETs are pivotal components in electronics, distinguished by their capacity to act as highly efficient switches. They are part of the larger family of metal-oxide Semiconductor Field-Effect Transistors (MOSFETs). They are available in two types: p-channel and n-channel, each tailored to specific polarity operations.
In their basic form, enhancement-mode MOSFETs are typically non-conductive when the gate-source voltage (Vgs) is zero. This default 'off' state means no...
1.0K
Biasing of Metal-Semiconductor Junctions01:27

Biasing of Metal-Semiconductor Junctions

810
Biasing metal-semiconductor junctions involves applying a voltage across the junction. Specifically, the metal is connected to a voltage source, while the semiconductor is grounded. This technique is essential for controlling the direction and magnitude of current flow in electronic devices, including diodes, transistors, and photovoltaic cells.
In Schottky junctions, where the semiconductor is n-type, applying a positive voltage to the metal relative to the semiconductor reduces its Fermi...
810
MOSFET01:16

MOSFET

1.6K
The Metal-Oxide-Semiconductor Field-Effect Transistor (MOSFET) plays a pivotal role in modern electronics thanks to its versatility and efficiency in controlling electrical currents. This device, also known as IGFET, MISFET, and MOSFET, has three main terminals: the Source, Drain, and Gate. MOSFETs are classified into n-channel or p-channel types based on the doping characteristics of their substrate and the source or drain regions.
In an n-MOSFET, the structure includes n-type source and drain...
1.6K

You might also read

Related Articles

Articles linked to this work by shared authors, journal, and citation graph.

Sort by
Same author

Electrochemical Wiring of a Metal Nanofilament to Form a Molecular Junction.

The journal of physical chemistry letters·2026
Same author

Redox-Induced Atomic Switch as Platform for Molecular Electronics Devices.

Small (Weinheim an der Bergstrasse, Germany)·2025
Same author

Two Orders of Magnitude Reduction in Computational Load Achieved by Ultrawideband Responses of an Ion-Gating Reservoir.

ACS nano·2025
Same author

Sub-Millisecond and Energy-Efficient Electrochemical Synaptic Transistors with a Partially Reduced Graphene Oxide Channel.

ACS applied materials & interfaces·2025
Same author

Iono-Magnonic Reservoir Computing With Chaotic Spin Wave Interference Manipulated by Ion-Gating.

Advanced science (Weinheim, Baden-Wurttemberg, Germany)·2024
Same author

Solid polymer electrolyte-based atomic switches: from materials to mechanisms and applications.

Science and technology of advanced materials·2024

Related Experiment Video

Updated: Mar 30, 2026

Assembly and Characterization of Biomolecular Memristors Consisting of Ion Channel-doped Lipid Membranes
08:07

Assembly and Characterization of Biomolecular Memristors Consisting of Ion Channel-doped Lipid Membranes

Published on: March 9, 2019

8.4K

Synaptic Metaplasticity Realized in Oxide Memristive Devices.

Zheng-Hua Tan1, Rui Yang1, Kazuya Terabe2

  • 1Laboratory of Solid State Ionics, School of Materials Science and Engineering, Huazhong University of Science and Technology, Wuhan, 430074, P.R. China.

Advanced Materials (Deerfield Beach, Fla.)
|November 18, 2015
PubMed
Summary

Researchers developed artificial synapses using WO3 thin films to mimic metaplasticity, a complex form of synaptic plasticity. This breakthrough advances neuromorphic computing by demonstrating activity-dependent responses like spike-timing-dependent plasticity.

Keywords:
WO3memristive devicesmetaplasticityspike-timing-dependent plasticity

More Related Videos

In Situ Transmission Electron Microscopy with Biasing and Fabrication of Asymmetric Crossbars Based on Mixed-Phased a-VOx
09:49

In Situ Transmission Electron Microscopy with Biasing and Fabrication of Asymmetric Crossbars Based on Mixed-Phased a-VOx

Published on: May 13, 2020

4.4K
A Method for Growing Bio-memristors from Slime Mold
07:46

A Method for Growing Bio-memristors from Slime Mold

Published on: November 2, 2017

9.5K

Related Experiment Videos

Last Updated: Mar 30, 2026

Assembly and Characterization of Biomolecular Memristors Consisting of Ion Channel-doped Lipid Membranes
08:07

Assembly and Characterization of Biomolecular Memristors Consisting of Ion Channel-doped Lipid Membranes

Published on: March 9, 2019

8.4K
In Situ Transmission Electron Microscopy with Biasing and Fabrication of Asymmetric Crossbars Based on Mixed-Phased a-VOx
09:49

In Situ Transmission Electron Microscopy with Biasing and Fabrication of Asymmetric Crossbars Based on Mixed-Phased a-VOx

Published on: May 13, 2020

4.4K
A Method for Growing Bio-memristors from Slime Mold
07:46

A Method for Growing Bio-memristors from Slime Mold

Published on: November 2, 2017

9.5K

Area of Science:

  • Neuroscience
  • Materials Science
  • Computer Engineering

Background:

  • Metaplasticity, a higher-order form of synaptic plasticity, is crucial for understanding brain function.
  • Artificial synapses are key components for developing advanced neuromorphic computing systems.
  • Tungsten oxide (WO3) thin films offer promising material properties for electronic devices.

Purpose of the Study:

  • To realize metaplasticity using artificial synapses based on WO3 thin films.
  • To systematically investigate the activity-dependent metaplastic responses of these artificial synapses.
  • To highlight the implications of this research for neuromorphic computation.

Main Methods:

  • Fabrication of artificial synapses utilizing WO3 thin films.
  • Experimental investigation of synaptic plasticity mechanisms.
  • Characterization of activity-dependent responses, including spike-timing-dependent plasticity.

Main Results:

  • Successful implementation of metaplasticity in WO3-based artificial synapses.
  • Demonstration of characteristic activity-dependent responses, mimicking biological neural plasticity.
  • Validation of WO3 thin films as a suitable material for neuromorphic applications.

Conclusions:

  • Artificial synapses based on WO3 thin films can effectively emulate metaplasticity.
  • This work provides a novel pathway for developing more sophisticated neuromorphic computing architectures.
  • The findings have significant implications for future brain-inspired computing technologies.